DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk4

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:230 Identity:76/230 - (33%)
Similarity:112/230 - (48%) Gaps:15/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGTATTISSFPWQISL-QRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIR--AGSS 88
            :..||:.|......|.|||.:| ....:..|.|.:...:.:::||||:|......|.:.  .||.
  Rat    28 ISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQDSYTVGLGLHNLEGSQ 92

  Fly    89 YWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAASVSGW 153
            ...|..:.|.:|.  .|..||..:..||:.::.|:.|:..|:||:.|.:||..|..|....||||
  Rat    93 EPGSRMLEAHLSI--QHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQCPTPGDTCLVSGW 155

  Fly   154 GTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICAFASG---KDSCQGDSGGPLV 215
            |...:|  .:||.|:.||:::.|:..|...   |......||.|| ..|   ||:|.||||||:|
  Rat   156 GRLKNG--KLPSLLQCVNLSVASEETCRLL---YDPVYHLSMFCA-GGGPDRKDTCNGDSGGPIV 214

  Fly   216 SGGVLVGVVSWGYG-CAAANYPGVYADVAALRSWV 249
            ....|.|:||.|.| |.....|.||.::....:|:
  Rat   215 CNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 75/225 (33%)
Tryp_SPc 31..252 CDD:238113 75/226 (33%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 73/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.