DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Sems

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:124/263 - (47%) Gaps:16/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAV-----ACALGGTIPEGLL------PQLDGRIVGGTATTISSF-PWQISLQRSGSH 54
            |.||.||:.:     |.....||....|      |....|::||..||.:.. .:.::::...:.
  Fly     4 LLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNF 68

  Fly    55 SCGGSIYSARVIVTAAHCLQS-VSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIA 118
            .|||::....:::|||||.:. ....:..:..|.|..|..|:..:|..|.....:...||..|:|
  Fly    69 ICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVA 133

  Fly   119 VLHLSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSS 183
            |:.|:..: ....|..:.|.|:....|....|||||..:.........||.|:|.::.:..| ..
  Fly   134 VVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRIC-RE 196

  Fly   184 SYGYGNQIKSSMICAFASG-KDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRS 247
            :|.....|..||.||...| ||:|..|||||||....:.|:||:|.|||:..|||||.||..::.
  Fly   197 AYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKP 261

  Fly   248 WVI 250
            :::
  Fly   262 FIV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 70/221 (32%)
Tryp_SPc 31..252 CDD:238113 69/223 (31%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 70/221 (32%)
Tryp_SPc 44..265 CDD:238113 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.