DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG4613

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:254 Identity:89/254 - (35%)
Similarity:135/254 - (53%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHC---- 72
            :|..|       :|.:: ||||||....:.:||...:.|.....|||::.:.|.::|||||    
  Fly   126 SCTCG-------VPNVN-RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGM 182

  Fly    73 -LQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIG 136
             ::.||...||:...|::.   ||...|:....|.||:..::|:|||:|.|...:....|::...
  Fly   183 DMRGVSVRLLQLDRSSTHL---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244

  Fly   137 LASSNPAN--GAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICA- 198
            |.|:...|  ...|.|:|||....|.|: .|.|:.|.|.|::.::|.::|  |.:.|..:|:|| 
  Fly   245 LPSNWLQNFDFQKAIVAGWGLSQEGGST-SSVLQEVVVPIITNAQCRATS--YRSMIVDTMMCAG 306

  Fly   199 --FASGKDSCQGDSGGPLVSGG---VLVGVVSWGYGCAAANYPGVYADVAALRSWVINN 252
              ...|:|:|||||||||:...   .|.||||:|||||..:.||||..|:....|:..|
  Fly   307 YVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 84/231 (36%)
Tryp_SPc 31..252 CDD:238113 84/233 (36%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 84/231 (36%)
Tryp_SPc 137..362 CDD:238113 83/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.