DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG32833

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:242 Identity:67/242 - (27%)
Similarity:111/242 - (45%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSYWSSGGVV 96
            :||....|::.||..|:.......|.|:||....||||..|:.......:::|.||:..|.|.:.
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIE 103

  Fly    97 AKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSS 161
            ..|.:...||.:...|:.:::|:|.|...|..|.||:.|.||:..|:|||..:.:||        
  Fly   104 VAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGW-------- 160

  Fly   162 SIPS-----------------QLRYVNVNIVSQSRCSSSSYGYGNQIKSS----MICAFASGKDS 205
              ||                 :|:...|.::..|:| :..:...|..|.:    :.|.....|::
  Fly   161 --PSFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQC-TDLWARNNWSKKNFTDDLFCTEKFAKEA 222

  Fly   206 CQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVINN 252
            |....|.|:|..|.|||:::.| ||  :.||.||.::...:.|:.|:
  Fly   223 CSLAMGSPVVHNGKLVGIITKG-GC--SEYPEVYINLIKYKDWLHNH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 65/237 (27%)
Tryp_SPc 31..252 CDD:238113 66/240 (28%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 66/239 (28%)
Tryp_SPc 40..262 CDD:214473 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.