DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG11192

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:261 Identity:108/261 - (41%)
Similarity:145/261 - (55%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIV 67
            |||..|.|:....|.|...|     |||||||...||..||:|:|:|..|.|.|||:|.....::
  Fly     5 KFLWWLMALVAYAGATPTPG-----DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVL 64

  Fly    68 TAAHCLQSV-SASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSST 131
            |||||.:.. |::...:|.|||...|||.|..:.....|..||..:..||:|:|.|:..|:|:..
  Fly    65 TAAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129

  Fly   132 IKAIGLA--SSNPANGAAASVSGWGTES-----SGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGN 189
            ::.:.||  :..|.......|||||.::     ||...:..|||:|:|::|..::| ..:|....
  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC-RRAYSQVL 193

  Fly   190 QIKSSMICAFASGKDSCQGDSGGPLVSGGV------LVGVVSWGYGCAAANYPGVYADVAALRSW 248
            .|...||||...|:||||||||||||....      |.|:||||.|||..|:||||.:|||.|||
  Fly   194 PITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSW 258

  Fly   249 V 249
            :
  Fly   259 I 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 97/232 (42%)
Tryp_SPc 31..252 CDD:238113 97/233 (42%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 97/232 (42%)
Tryp_SPc 28..262 CDD:238113 97/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443276
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.