DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and thetaTry

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:254 Identity:114/254 - (44%)
Similarity:155/254 - (61%) Gaps:4/254 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGT--IPEGLLPQLDGRIVGGTATTISSFPWQISLQ-RSGSHSCGGSIYSA 63
            |..|::..||..|..||  :..|...:.:||||||..|||.:.|:|:||| :||||.||||:.:.
  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68

  Fly    64 RVIVTAAHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSF 128
            ..:|||||||.....|.:.:|.||:.::.||:|..|.....:|.||:.||..|:.:|.|...:..
  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTES-SGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIK 192
            :..|:.|.||:..|..|..|.|:|||::. ....::|..|:.|.||||....|:|..|.||..|.
  Fly   134 TENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIY 198

  Fly   193 SSMICAFASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVIN 251
            .||:||:...||:|||||||||..|..|||:|||||.||:...||||:||.|||.|::|
  Fly   199 DSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 103/220 (47%)
Tryp_SPc 31..252 CDD:238113 104/223 (47%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 103/220 (47%)
Tryp_SPc 35..255 CDD:238113 102/219 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.850

Return to query results.
Submit another query.