DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and etaTry

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:115/262 - (43%)
Similarity:149/262 - (56%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHS------CGGS 59
            |.|.::.:.||...||   ...:..|.|||||||..|:.....:.:.|:|..|.|      |||.
  Fly     1 MNKVILRILAVLFLLG---IYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGC 62

  Fly    60 IYSARVIVTAAHCLQSVSASSLQIRAG-SSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLS 123
            |..|..|.|||||:.:..|.:..:.|| .|.....|||.:||....||.||::||.||||::.:.
  Fly    63 ILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVD 127

  Fly   124 SSL---SFSSTIKAIGLASSNPANGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRCSSSS 184
            ..|   || ||::||.:||..||.|..|::|||| |:.:|.||  .||:.|.|.||...:|..:.
  Fly   128 PPLPLDSF-STMEAIEIASEQPAVGVQATISGWGYTKENGLSS--DQLQQVKVPIVDSEKCQEAY 189

  Fly   185 YGYGNQIKSSMICAFAS--GKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRS 247
              |...|...|:||..|  |||:||||||||||....|.|:||||.|||..|||||||:||..:.
  Fly   190 --YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKD 252

  Fly   248 WV 249
            |:
  Fly   253 WI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 105/231 (45%)
Tryp_SPc 31..252 CDD:238113 105/232 (45%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 105/231 (45%)
Tryp_SPc 28..257 CDD:238113 105/232 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.