DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and PRSS53

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:308 Identity:73/308 - (23%)
Similarity:119/308 - (38%) Gaps:79/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHC 72
            |.|...|.|...|....|| :|..|.|      .:|||.|::|.|:|.|.||:.:...::|||||
Human    21 LQAAQRACGQRGPGPPKPQ-EGNTVPG------EWPWQASVRRQGAHICSGSLVADTWVLTAAHC 78

  Fly    73 LQSVSASSL---QIRAGS---SYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSST 131
            .:..:|:.|   .:..||   ...|.|.....|::.:....||..:..:|:|:|.|:...:.:. 
Human    79 FEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHPTTHTP- 142

  Fly   132 IKAIGLASSNPAN----GAAASVSGWGTESSGS-------------------------------- 160
                 |....||:    ||:...:||..::|..                                
Human   143 -----LCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLL 202

  Fly   161 ------------SSIPSQLRYVNVNIVSQSRCSS-----SSYGYGNQIKSSMICAFASG--KDSC 206
                        |..|..||.:.:.::|:..|:.     ......|..:..|:|.....  :..|
Human   203 PRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPC 267

  Fly   207 QGDSGGPLV-----SGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            |||||||::     ...|..|::|:...||..:.|.:..:.||..||:
Human   268 QGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 64/284 (23%)
Tryp_SPc 31..252 CDD:238113 65/285 (23%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 65/286 (23%)
Tryp_SPc 43..314 CDD:214473 63/282 (22%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.