DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Ser6

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:259 Identity:86/259 - (33%)
Similarity:129/259 - (49%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVI 66
            |.||:|  .|..|.|         :|:||:|||.....:.||.|:||:.:|||||||||.:...|
  Fly    14 LLFLVL--PVQSAPG---------KLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYI 67

  Fly    67 VTAAHCLQS---------VSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHL 122
            :|||||:.:         ::|....|||||:...||||:.:|:....||.|  ...:||:|:|.|
  Fly    68 LTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRL 130

  Fly   123 SSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSS-SSYG 186
            .|.|..|::|:.|.|.:.:........:|||| .......:|..|:|..:..:::.:|.. ..:|
  Fly   131 ESPLILSASIQPIDLPTVDTPADVDVVISGWG-RIKHQGDLPRYLQYNTLKSITRQQCEELIDFG 194

  Fly   187 YGNQIKSSMICAFAS-GKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            :..:     :|.... ...:|.||||||.|....||||..:......:.||..||.|...:.|:
  Fly   195 FEGE-----LCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 76/229 (33%)
Tryp_SPc 31..252 CDD:238113 76/230 (33%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 76/229 (33%)
Tryp_SPc 32..256 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.