DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and tmprss4b

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:249 Identity:93/249 - (37%)
Similarity:132/249 - (53%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCL- 73
            :|:|:..|.:..      :.|||||..|:|..:|||:|||.:..|.||||:.|...|::||||. 
Zfish   187 SVSCSDCGEVVG------EDRIVGGVETSIEHWPWQVSLQFNHRHMCGGSLLSTSWIISAAHCFT 245

  Fly    74 ---QSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAI 135
               |.:|..:: :...:......||  .|.....|:.||..|...|||:|.|:..:....:|..:
Zfish   246 GRTQELSRWTV-VLGQTKVMDVVGV--SVDMIVIHKDYNRLTNDFDIAMLKLTWPVKTGESILPV 307

  Fly   136 GLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICA-F 199
            .|.....|......|:|||....| .::|:.|:..:|.:|::|.||..:. |.:.|...|:|| |
Zfish   308 CLPPHQLAIKDMLVVTGWGLLKEG-GALPTVLQKASVPLVNRSECSKPTI-YSSSITPRMLCAGF 370

  Fly   200 ASGK-DSCQGDSGGPLV---SGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            ..|. |:||||||||||   |...|:|:||||.|||....|||||||..|..|:
Zfish   371 LQGNVDACQGDSGGPLVYLSSRWQLIGIVSWGVGCAREGKPGVYADVTQLLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 89/227 (39%)
Tryp_SPc 31..252 CDD:238113 89/228 (39%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133
SRCR 105..>175 CDD:278931
Tryp_SPc 201..424 CDD:214473 89/227 (39%)
Tryp_SPc 202..427 CDD:238113 89/228 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.