DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG4653

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:117/259 - (45%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAA 70
            :||..|...| |.:....||           ..:.|.|..|||:|:|.|.|||::...:.|:|||
  Fly    12 LLLLVVIVTL-GVVQSSRLP-----------AEVGSQPHSISLRRNGVHVCGGALIREKWILTAA 64

  Fly    71 HCL------QSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMV--NDIAVLHLSSSLS 127
            ||:      ||..|.|..:|.||....:||.:..:|....|..|:::..|  ||:|:|.|.:|:.
  Fly    65 HCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVV 129

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIK 192
            .::....|.||:..||.|:....||||: |....|:...|:......:|.|.|.:..|    ..:
  Fly   130 LNANTNPIDLATERPAAGSQIIFSGWGS-SQVDGSLSHVLQVATRQSLSASDCQTELY----LQQ 189

  Fly   193 SSMICAFASGKD---SCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWVINNA 253
            ..::|.....:|   .|.||:|.|......|||:.::......:..|..|.||.....|:..||
  Fly   190 EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINENA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 67/229 (29%)
Tryp_SPc 31..252 CDD:238113 68/231 (29%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/237 (29%)
Tryp_SPc 30..249 CDD:214473 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.