DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG9673

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:132/270 - (48%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARV 65
            :|.|.::|||.|.           ||  |||:||.......:||..|::.:.:|.|.|:|.|...
  Fly    12 LLIFGLILSAEAS-----------PQ--GRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNH 63

  Fly    66 IVTAAHCLQS-----VSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSS 125
            |:|||||:.|     |.||:|.:|.|:....:||.:..|.|...|..|  ...::|||:|.|..:
  Fly    64 ILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSY--GNFLHDIAILELDET 126

  Fly   126 LSFSSTIKAIGL----------ASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRC 180
            |.||..|:.|.|          ..:...||....|:|||..|.|::|...|  ..|.|.:|:|.|
  Fly   127 LVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQ--KANYNTLSRSLC 189

  Fly   181 S-SSSYGYGNQIKSSMIC-AFASGKDSCQGDSGGPLVSGG-VLVGVVSWGYGCAAANYPGVYADV 242
            . .:.|||     .|::| :.|.|:..|:||:|..::... ||.|:.|:.:|...:.||.|...|
  Fly   190 EWEAGYGY-----ESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRV 249

  Fly   243 AALRSWVINN 252
            :...:|:..|
  Fly   250 SYYLTWIEAN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 77/236 (33%)
Tryp_SPc 31..252 CDD:238113 77/238 (32%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 77/236 (33%)
Tryp_SPc 29..259 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.