DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG33160

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:227 Identity:80/227 - (35%)
Similarity:125/227 - (55%) Gaps:10/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSYW 90
            |:..||:||..::|....:.:.:..| ...||||:...|.::|||||:.:.:.:..:|..|:|  
  Fly    29 QIQPRIIGGHVSSIKEEKYLVQVTTS-EELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGAS-- 90

  Fly    91 SSGG---VVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAASVSG 152
            :..|   |:..|........:|..|:..|:|.|.|:|.: ..:.|:.|.||:.:....|...|||
  Fly    91 NQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQSVPARALVKVSG 154

  Fly   153 WGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICAF-ASGKDSCQGDSGGPLVS 216
            ||..::.::....::..|.|.:.|::.|.|:..|. ::|..||:||. ...||||.||||||||.
  Fly   155 WGFLTADATKTAERVHSVLVPMWSRASCVSAFRGI-HRITRSMVCAARLYKKDSCDGDSGGPLVY 218

  Fly   217 GGVLVGVVSWGYGCAAANYPGVYADVAALRSW 248
            .|.|.|:||:|||||:| .||:|..|..:|.|
  Fly   219 RGQLAGIVSFGYGCASA-LPGIYTSVPEIRDW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 79/223 (35%)
Tryp_SPc 31..252 CDD:238113 78/222 (35%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 78/221 (35%)
Tryp_SPc 34..253 CDD:238113 78/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.