DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG31681

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:256 Identity:109/256 - (42%)
Similarity:144/256 - (56%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARV 65
            :|..|:.::.:|||       ..:|..:.|||||:...|...|||:|:|.:..|.|||.|||.|.
  Fly     6 LLSILVSIAGLACA-------ARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA 63

  Fly    66 IVTAAHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVN--DIAVLHLSSSLSF 128
            |:||||||.:|:.:.|.:||||||||.||.|.||.....|..| ...:.|  |||||.|.:.|..
  Fly    64 ILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRL 127

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKS 193
            ..|:|.|.||...|..|.....||||.....||.:...|:.|:|.|::::.| ..:|.:.| |..
  Fly   128 GGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDC-LKAYKHVN-ITI 190

  Fly   194 SMICAFASGKDSCQGDSGGPLV---SGG--VLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            .||||.....|:|||||||||:   .||  .|:|:||||.||  ...||||.|:|...:|:
  Fly   191 DMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGC--GTNPGVYEDIAFFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 102/225 (45%)
Tryp_SPc 31..252 CDD:238113 102/226 (45%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 102/225 (45%)
Tryp_SPc 29..250 CDD:238113 102/226 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443198
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.