DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and CG32808

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:258 Identity:88/258 - (34%)
Similarity:133/258 - (51%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQR--SGSHSCGGSIYSARVIV 67
            |.|.......|.|...|      ||:||.||......||:.:||:|  ||.||||.::.:...::
  Fly    10 LALFYTATFLLAGASGE------DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVL 68

  Fly    68 TAAHCLQSVSASSLQIRAGSSYWS-SGGVVAKVSSFKNHEGYN-ANTMVNDIAVLHLSSSLSFSS 130
            |||||::..|...|.::.||...: :...||:|::...|.||. .:..|||||:|.|:.|::.|.
  Fly    69 TAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSK 133

  Fly   131 TIKAIGLASS---NPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIK 192
            .::.:.|...   .|.| |:|.::|||..::| ..:...|:.|.:.:.|.:.||.....|   :.
  Fly   134 FVQPVRLPEPRQVTPGN-ASAVLAGWGLNATG-GVVQQHLQKVKLQVFSDTECSERHQTY---LH 193

  Fly   193 SSMICAF--ASGKDSCQGDSGGP--LVSGGVLVGVVSWGY-GCAAANYPGVYADVAALRSWVI 250
            .|.|||.  ..||..|.||||||  |:.....||:|||.. .||...:|||:.:|:|...|::
  Fly   194 DSQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 80/230 (35%)
Tryp_SPc 31..252 CDD:238113 81/232 (35%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/230 (35%)
Tryp_SPc 30..258 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.