DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk14

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:257 Identity:93/257 - (36%)
Similarity:129/257 - (50%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHS--CGGSIYSA 63
            ||..|.:|.|:|.|:       :..|.|.:|:||.....:|.|||::||......  |||.:.|.
  Rat    61 MLLLLTILQALAVAI-------VQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSD 118

  Fly    64 RVIVTAAHCLQSVSASSLQIRAGS---SYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSS 125
            :.::|||||.:.:    |.:..|.   ..|.:...|.:|.....|..|......||:.:|.|...
  Rat   119 QWVITAAHCARPL----LHVALGKHNLRRWEATQQVLRVVRQVPHPQYRPQAHDNDLMLLKLQRK 179

  Fly   126 LSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQ 190
            :.....::.|.:|.|..:.|....||||||.:|.....|:.|:.|||||:.:..|..:   |...
  Rat   180 VRLGRAVRTIPVARSCASPGTPCRVSGWGTTASPIVRYPTALQCVNVNIMPEQVCHRA---YPGT 241

  Fly   191 IKSSMICAFA--SGKDSCQGDSGGPLVSGGVLVGVVSWGY-GCAAANYPGVYADVAALRSWV 249
            |.|.|:||..  .||||||||||||||..|.|.|:||||. .||...|||||.::....||:
  Rat   242 ITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 83/226 (37%)
Tryp_SPc 31..252 CDD:238113 84/227 (37%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 84/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.