DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Elane

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:239 Identity:66/239 - (27%)
Similarity:116/239 - (48%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSY 89
            |.|...||||......::|:.:||||.|.|.||.::.:...:::||||:...:..|:|:..|:..
  Rat    27 PALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCVNGRNFQSVQVVLGAHD 91

  Fly    90 WSSGGVVAKVSS----FKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAAS- 149
            ........::.|    |:|  |::.:.::|||.::.|:.|.:.::.::...|    ||.|.... 
  Rat    92 LRRREPTRQIFSVQRIFEN--GFDPSRLLNDIVIIQLNGSATINANVQVAEL----PAQGQGVGN 150

  Fly   150 -----VSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICAFASGKDS--CQ 207
                 ..|||...: :..:||.|:.:||.:|: :.|.          :...:|.....:.:  |.
  Rat   151 RTPCVAMGWGRLGT-NRPLPSVLQELNVTVVT-NLCR----------RRVNVCTLVPRRQAGICF 203

  Fly   208 GDSGGPLVSGGVLVGVVSW--GYGCAAANYPGVYADVAALRSWV 249
            ||||||||...::.|:.|:  | ||.:..||..:|.||....|:
  Rat   204 GDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 63/232 (27%)
Tryp_SPc 31..252 CDD:238113 64/233 (27%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 63/232 (27%)
Tryp_SPc 33..249 CDD:238113 64/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.