DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk1c3

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:259 Identity:81/259 - (31%)
Similarity:120/259 - (46%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVT 68
            ||||..|::.......|.|     ..|:|||.....:|.|||:::  .....|||.:.....::|
  Rat     3 FLILFLALSLGQIDAAPPG-----QSRVVGGFKCEKNSQPWQVAV--INEDLCGGVLIDPSWVIT 60

  Fly    69 AAHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTM----------VNDIAVLHLS 123
            ||||.    :.:..:..|.:..|.......||....|..|....|          .||:.:||||
  Rat    61 AAHCY----SDNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLS 121

  Fly   124 SSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYG 188
            .....:..:|.|.|.:..|..|:...|||||:.:......|..|:.||::::|..:|..:   |.
  Rat   122 EPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSNEKCIKA---YK 183

  Fly   189 NQIKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWG-YGCAAANYPGVYADVAALRSWV 249
            .::...|:||  ...|||:|:|||||||:..|||.|:.||| ..|...|.||:|..:....||:
  Rat   184 EKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 73/231 (32%)
Tryp_SPc 31..252 CDD:238113 73/232 (31%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 73/231 (32%)
Tryp_SPc 25..250 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.