DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk11

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:84/275 - (30%)
Similarity:126/275 - (45%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACAL-----GGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSI 60
            :|:.:::|..:|.||     ||          :.||:.|......|.|||::|.:.....||.::
  Rat    26 LLQAMMILRFIALALVTGHVGG----------ETRIIKGYECRPHSQPWQVALFQKTRLLCGATL 80

  Fly    61 YSARVIVTAAHC-------------LQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANT 112
            .:.:.::|||||             |:.......:..|..|:              .|.|:| |:
  Rat    81 IAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESF--------------PHPGFN-NS 130

  Fly   113 MV-----NDIAVLHLSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNV 172
            :.     |||.::.:||....:..::.:.|:|.....|.:..:|||||.||....:|..||..||
  Rat   131 LPNKDHRNDIMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANV 195

  Fly   173 NIVSQSRCSSSSYGYGNQIKSSMICAFA--SGKDSCQGDSGGPLVSGGVLVGVVSWGYG-CAAAN 234
            :|:....|..:   |...|..:|:||..  .||||||||||||||..|.|.|::|||.. ||...
  Rat   196 SIIGHKECERA---YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTR 257

  Fly   235 YPGVYADVAALRSWV 249
            .||||..|.....|:
  Rat   258 KPGVYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 76/239 (32%)
Tryp_SPc 31..252 CDD:238113 76/240 (32%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 76/239 (32%)
Tryp_SPc 51..275 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.