DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:279 Identity:95/279 - (34%)
Similarity:131/279 - (46%) Gaps:43/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLS---------AVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGS--- 53
            |||.|:||:         |..|.:...:          .||||...:.|.:|||:||:...|   
  Rat     1 MLKLLLLLALSPLASLVHAAPCPVKQRV----------GIVGGREASESKWPWQVSLRFKFSFWM 55

  Fly    54 HSCGGSIYSARVIVTAAHC----LQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMV 114
            |.||||:...:.::|||||    ::|.....:|:|....|::.  .:..|:....|..|......
  Rat    56 HFCGGSLIHPQWVLTAAHCVGLHIKSPELFRVQLREQYLYYAD--QLLTVNRTVVHPHYYTVEDG 118

  Fly   115 NDIAVLHLSSSLSFSSTIKAIGL--ASSNPANGAAASVSGWGTESSGSSSIPS-QLRYVNVNIVS 176
            .|||:|.|.:.::.|:.|....|  ||....:|.:..|:|||...|....:|. .|:.|.|.||.
  Rat   119 ADIALLELENPVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVE 183

  Fly   177 QSRCSSSSYGYGNQ-------IKSSMICAFASGKDSCQGDSGGPL---VSGGVL-VGVVSWGYGC 230
            .|.| ...|..|..       ::..|:||..:..|||||||||||   |.|..| .||||||.||
  Rat   184 NSLC-DRKYHTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGC 247

  Fly   231 AAANYPGVYADVAALRSWV 249
            |.||.||:|..|.....|:
  Rat   248 AEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 86/239 (36%)
Tryp_SPc 31..252 CDD:238113 87/240 (36%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 87/240 (36%)
Tryp_SPc 30..266 CDD:214473 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.