DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prss29

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:268 Identity:96/268 - (35%)
Similarity:134/268 - (50%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQ------RSGSHSCGGSIYSA 63
            ||.|.:....:..::||.:|.    .||||.:.....:|||:||:      .|..|.|||||...
  Rat     9 LIFLGSSIAGIPASVPEDVLV----GIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHP 69

  Fly    64 RVIVTAAHCLQSVSA--SSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSL 126
            :.::|||||:....|  |:.:|..|..|...|..:.|||....|..:..:.:.:|:|:|.|:.|:
  Rat    70 QWVLTAAHCIHESDADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSV 134

  Fly   127 SFSSTIKAIGL--ASSNPANGAAASVSGWGTESSGSS-SIPSQLRYVNVNIVSQSRCSS------ 182
            .....:|.:.|  ||..........|:|||:.|...| ..|.:|:.|.|.||..:.|..      
  Rat   135 RSFPNVKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNAT 199

  Fly   183 --SSYGYGNQIKSSMICAFASGKDSCQGDSGGPLV----SGGVLVGVVSWGYGCAAANYPGVYAD 241
              |::|. ..|...|:||.:.|:|||.||||||||    ....||||||||||||..:.|||||.
  Rat   200 RLSNHGQ-RLILQDMLCAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYAR 263

  Fly   242 VAALRSWV 249
            |.....|:
  Rat   264 VQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 89/241 (37%)
Tryp_SPc 31..252 CDD:238113 90/242 (37%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117904
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.