DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prss2

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:256 Identity:89/256 - (34%)
Similarity:136/256 - (53%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVI 66
            ::.|:.|:.|..|:...:.:      |.:||||.....:|.|:|:|| .||.|.||||:.:.:.:
  Rat     1 MRALLFLALVGAAVAFPVDD------DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWV 58

  Fly    67 VTAAHCLQSVSASSLQIRAGSSYWSSGGVVAKVSSFKN------HEGYNANTMVNDIAVLHLSSS 125
            |:||||.:    |.:|:|.|.   .:..|:.....|.|      |..::..|:.|||.::.|||.
  Rat    59 VSAAHCYK----SRIQVRLGE---HNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSP 116

  Fly   126 LSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQ 190
            :..::.:..:.|.||....|....:||||...|...:.|..|:.::..::.|:.|.:|   |..:
  Rat   117 VKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEAS---YPGK 178

  Fly   191 IKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            |..:|:|.  ...||||||||||||:|..|.|.|:||||||||..:.||||..|.....|:
  Rat   179 ITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 83/226 (37%)
Tryp_SPc 31..252 CDD:238113 84/227 (37%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 83/226 (37%)
Tryp_SPc 24..242 CDD:238113 84/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.