DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk1c2

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:243 Identity:73/243 - (30%)
Similarity:114/243 - (46%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSY 89
            |....|||||.....:|.|||:::  ...:.|||.:.....::|||||.    :::.|:..|.:.
  Rat    19 PPGQSRIVGGYKCEKNSQPWQVAV--INEYLCGGVLIDPSWVITAAHCY----SNNYQVLLGRNN 77

  Fly    90 WSSGGVVAK----VSSFKNHEGY-----------NANTMVNDIAVLHLSSSLSFSSTIKAIGLAS 139
            .......|:    ..||: |..|           ..:...||:.:||||.....:..:|.|.|.:
  Rat    78 LFKDEPFAQRRLVRQSFR-HPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPT 141

  Fly   140 SNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMICA--FASG 202
            ..|..|:....||||:.:.....:...|:.||::::|..:|..:   |.:.:...|:||  ...|
  Rat   142 KEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIET---YKDNVTDVMLCAGEMEGG 203

  Fly   203 KDSCQGDSGGPLVSGGVLVGVVSWG-YGCAAANYPGVYADVAALRSWV 249
            ||:|.|||||||:..|||.|:.|.| ..||....|.:||.:....||:
  Rat   204 KDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 71/236 (30%)
Tryp_SPc 31..252 CDD:238113 71/237 (30%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.