DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Try4

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:262 Identity:89/262 - (33%)
Similarity:140/262 - (53%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVI 66
            ::.|:.|:.|..|:...:.:      |.:||||.....:|.|:|:|| .||.|.||||:.:.:.:
Mouse     1 MRALLFLALVGAAVAFPVDD------DDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWV 58

  Fly    67 VTAAHCLQSVSASSLQIRAG----------SSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLH 121
            |:||||.:    |.:|:|.|          ..:.:|..::       .|..:|:.|:.|||.::.
Mouse    59 VSAAHCYK----SRIQVRLGEHNINVLEGNEQFVNSAKII-------KHPNFNSRTLNNDIMLIK 112

  Fly   122 LSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYG 186
            |:|.::.::.:..:.|.||....|....:||||...|...:.|..|:.::..::.|:.|.:|   
Mouse   113 LASPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEAS--- 174

  Fly   187 YGNQIKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            |..:|.::|||.  ...||||||||||||:|..|.|.|:||||||||..:.||||..|.....|:
Mouse   175 YPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

  Fly   250 IN 251
            .|
Mouse   240 QN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 82/230 (36%)
Tryp_SPc 31..252 CDD:238113 84/233 (36%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 82/230 (36%)
Tryp_SPc 24..242 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.