DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prss8

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:140/270 - (51%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGTIPE---GLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSA 63
            |..|:|:..:...:|....|   |.:  :..||.||.:.....:|||:|:..:|.|.||||:.|.
  Rat    15 LFILLLIGLLQSRIGADGTEASCGAV--IQPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSN 77

  Fly    64 RVIVTAAHCL-QSVSASSLQIRAGS---SYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSS 124
            :.:|:||||. :..|....:::.|:   ..:|:..||..|:...:|..|.......|||::.|||
  Rat    78 QWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSS 142

  Fly   125 SLSFSSTIKAIGLASSNPA--NGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRCSSSSYG 186
            .::||..|:.|.|.::|.:  ||...:|:||| ...|.|...|..|:.:.|.::|:..| |..|.
  Rat   143 PVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETC-SCLYN 206

  Fly   187 YG------NQIKSSMICA--FASGKDSCQGDSGGPL---VSG-GVLVGVVSWGYGCAAANYPGVY 239
            ..      :.|:..|:||  ...|||:|||||||||   :.| ..|.|:||||..|.|.|.||||
  Rat   207 INAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVY 271

  Fly   240 ADVAALRSWV 249
            ...:...||:
  Rat   272 TLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 86/237 (36%)
Tryp_SPc 31..252 CDD:238113 86/238 (36%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 86/237 (36%)
Tryp_SPc 45..284 CDD:238113 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.