DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:262 Identity:75/262 - (28%)
Similarity:119/262 - (45%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRS---GSHSCGGSIYSARV 65
            ||:|    |..:||.:..       .:||||......|.|:..|||.|   |||.|||::...|.
Mouse    14 FLLL----ALVVGGAVQA-------SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRF 67

  Fly    66 IVTAAHCLQSVSASSLQIRAGSSYWSSGG------VVAKVSSFKNHEGYNANTMVNDIAVLHLSS 124
            ::|||||||.:|...:.:..|:....|..      .:::|  |:|:  ||....:||:.:|.|:.
Mouse    68 VLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQV--FQNN--YNPEENLNDVLLLQLNR 128

  Fly   125 SLSFSSTIKAIGLASSNP--ANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGY 187
            :.|....:....|...:.  :.|......|||...: .:..|..|:.:||.:|: ..|       
Mouse   129 TASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGT-QAPTPRVLQELNVTVVT-FLC------- 184

  Fly   188 GNQIKSSMICAFASGKDS--CQGDSGGPLVSGGVLVGVVSWGY-GCAAANYPGVYADVAALRSWV 249
                :...:|.....:.:  |.|||||||:..|:|.||.|:.. .||:..:|..:|.|:....|:
Mouse   185 ----REHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWI 245

  Fly   250 IN 251
            .|
Mouse   246 QN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 67/232 (29%)
Tryp_SPc 31..252 CDD:238113 69/235 (29%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 67/232 (29%)
Tryp_SPc 30..248 CDD:238113 69/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.