DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and try-1

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:264 Identity:92/264 - (34%)
Similarity:133/264 - (50%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTIPEGLLPQ------------LDGRIVGGTATTISSFPWQIS-LQRSGSHSCGG 58
            ::..|.|.|..|..|  |.|            ||.|::||:.::..|:||.:. |.|.|.|.|||
 Worm    24 VIEKVGCGLHSTNVE--LAQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGG 86

  Fly    59 SIYSARVIVTAAHCL-QSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVN-DIAVLH 121
            |:.....::|||||. :....:|..:|.| .:.|..|...:|::...|..||.....: |.|::.
 Worm    87 SLIDPNFVLTAAHCFAKDRRPTSYSVRVG-GHRSGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMR 150

  Fly   122 LSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYG 186
            :...::.|:|.:.|.|.|..........|:|||:...|||.....||.::|.::|...|||....
 Worm   151 IHPPVNTSTTARPICLPSLPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNY 215

  Fly   187 YGNQIKSSMICA-FASGK-DSCQGDSGGPLVSG----GVLVGVVSWGYGCAAANYPGVYADVAAL 245
            .|.....||:|| ::.|| |||||||||||:..    ..|.||||||.|||....||||.:|.:.
 Worm   216 IGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSA 280

  Fly   246 RSWV 249
            .:|:
 Worm   281 STWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 82/227 (36%)
Tryp_SPc 31..252 CDD:238113 82/228 (36%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 82/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.