DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:272 Identity:93/272 - (34%)
Similarity:128/272 - (47%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIPEGLLP--QLDGRIVGGTATTISSFPWQISLQ---RSGSHSCGGSI 60
            |||.|:||......|...:.....|  |..| ||||...:.|.:|||:||:   ....|.||||:
Mouse     1 MLKRLLLLLWALSLLASLVYSAPRPANQRVG-IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSL 64

  Fly    61 YSARVIVTAAHC----LQSVSASSLQIRAGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLH 121
            ...:.::|||||    ::|.....:|:|....|:  |..:..::....|..|.......|:|:|.
Mouse    65 IHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYY--GDQLLSLNRIVVHPHYYTAEGGADVALLE 127

  Fly   122 LSSSLSFSSTIKAIGL--ASSNPANGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRCSSS 183
            |...::.|:.:..|.|  ||.....|.:..|:||| .::......|..|:.|.|.||..|.| ..
Mouse   128 LEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLC-DR 191

  Fly   184 SYGYGNQ-------IKSSMICAFASGKDSCQGDSGGPL---VSGGVL-VGVVSWGYGCAAANYPG 237
            .|..|..       :...|:||..:.:|||||||||||   |.|..| .||||||.|||..|.||
Mouse   192 KYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPG 256

  Fly   238 VYADVAALRSWV 249
            :|..|.....|:
Mouse   257 IYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 82/239 (34%)
Tryp_SPc 31..252 CDD:238113 83/240 (35%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.