DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Klk1b5

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:263 Identity:79/263 - (30%)
Similarity:120/263 - (45%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVT 68
            ||||.  :|.:|||.   ...|.:..||.||.....:|.|||:::.|...:.|||.:.:|..::|
Mouse     3 FLILF--LALSLGGI---DAAPPVQSRIFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLT 62

  Fly    69 AAHCLQSVSASSLQIRAGSSYWSSGGVVAK---VSSFKNHEGYNANTM-----------VNDIAV 119
            ||||    .....|:..|.:.:......|:   ||....|..:|.:.:           .||:.:
Mouse    63 AAHC----HNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLML 123

  Fly   120 LHLSSSLSFSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSS 184
            |.|......:..:|.|.|.:..|..|:....||||:.:.........|:.||..::....|..: 
Mouse   124 LRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKA- 187

  Fly   185 YGYGNQIKSSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYG-CAAANYPGVYADVAALR 246
              :..::...|:||  ...|||:|.|||||||:..|||.|:.|||.. |...|.||:|..:....
Mouse   188 --HIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIYTKLIKFN 250

  Fly   247 SWV 249
            ||:
Mouse   251 SWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 69/235 (29%)
Tryp_SPc 31..252 CDD:238113 69/236 (29%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 69/235 (29%)
Tryp_SPc 25..256 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.