DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and PRSS36

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:259 Identity:82/259 - (31%)
Similarity:128/259 - (49%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PEGL---LPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTAAHCLQSVSASSL 81
            ||.|   .|:...|||||:.....::|||:||...|.|.||||:.:...:::||||.  ::..:|
Human    33 PEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCF--MTNGTL 95

  Fly    82 QIRAGSSYWS------------SGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIKA 134
            :   .::.||            .|.....|::......|:...:..|:|:|.|:|..|....:..
Human    96 E---PAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWP 157

  Fly   135 IGL--ASSNPANGAAASVSGWG-TESSGSSSIPSQLRYVNVNIVSQSRCSS--SSYGYGN---QI 191
            :.|  ||....:|.|...:||| .:.:....:|..|:.|.:.::.::.|..  |..|..|   ||
Human   158 VCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQI 222

  Fly   192 KSSMICA-FASG-KDSCQGDSGGPLV--SGG--VLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            ...|:|| :..| :|:||||||||||  .||  ...|:.|:|:||...|.|||:..||...:|:
Human   223 LPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 77/244 (32%)
Tryp_SPc 31..252 CDD:238113 77/245 (31%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 77/244 (32%)
Tryp_SPc 47..289 CDD:238113 77/245 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.