DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and LOC105945797

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:254 Identity:88/254 - (34%)
Similarity:135/254 - (53%) Gaps:25/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARV 65
            :|...:||.|.|..            .|.:||||.....:|.|:.:|| .:|.|.||||:.|::.
 Frog     3 LLLLCVLLGAAAAF------------DDDKIVGGYTCAPNSVPYIVSL-NAGYHFCGGSLISSQW 54

  Fly    66 IVTAAHCLQSVSASSLQIRAGS-SYWSSGGVVAKVSSFK--NHEGYNANTMVNDIAVLHLSSSLS 127
            :|:||||..    :.:::|.|. ...::.|....::|.|  .::||:..|:.|||.::.|::...
 Frog    55 VVSAAHCFM----NKIEVRLGEHDIKATEGTEQFINSAKVIKNKGYSPRTLDNDIMLIKLATPAI 115

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIK 192
            .:..:..:.|.|......|...:||||...|..|:.|:.|:.|:..:::...|:.:   |..:|.
 Frog   116 LNQYVSPVPLPSGCIEPRANCLISGWGNTLSSGSNYPNLLQCVSAPVLTADECNKA---YPGEIT 177

  Fly   193 SSMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            .:|||.  ...||||||||||||:|..|.|.|:||||||||..||||||..|....:|:
 Frog   178 QNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAEKNYPGVYTKVCNYNAWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 81/223 (36%)
Tryp_SPc 31..252 CDD:238113 82/224 (37%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 82/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.