DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and prss59.2

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:253 Identity:96/253 - (37%)
Similarity:137/253 - (54%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFLILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVI 66
            |.||:||.| |.||.           |.:||||.....:|.|||.|| .||.|.||||:.|...:
Zfish     4 LVFLVLLGA-AFALD-----------DDKIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEYWV 55

  Fly    67 VTAAHCLQSVSASSLQIRAGS-SYWSSGGVVAKVSSFK--NHEGYNANTMVNDIAVLHLSSSLSF 128
            |:||||.:    |.|::|.|. :...:.|....::|.|  .:..|::.|:.:||.::.||...:.
Zfish    56 VSAAHCYK----SRLEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWTIDSDIMLIKLSKPATL 116

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKS 193
            :..::.:.|.:...|:|....|||||...| |::..::|:.:.:.|:|...|.:|   |...|..
Zfish   117 NKYVQPVALPNGCAADGTMCRVSGWGNTMS-STADSNKLQCLEIPILSDRDCKNS---YPGMITD 177

  Fly   194 SMICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            :|.||  ...||||||||||||:|..|.|.|:||||||||..:.||||..|.....|:
Zfish   178 TMFCAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 85/223 (38%)
Tryp_SPc 31..252 CDD:238113 86/224 (38%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 85/223 (38%)
Tryp_SPc 21..238 CDD:238113 86/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.