DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaTry and Gm2663

DIOPT Version :9

Sequence 1:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:252 Identity:90/252 - (35%)
Similarity:120/252 - (47%) Gaps:24/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLILLSAVACALGGTIPEGLLP-QLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIV 67
            |..|.:|||           || ..|.:||||......|.|:|:||....||.||||:.:.:.::
Mouse     7 FTFLGAAVA-----------LPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLINDQWVL 60

  Fly    68 TAAHCLQSVSASSLQIRAGS---SYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFS 129
            :||||.:    ..||:|.|.   .....|...........|..||.:|:.|||.::.|.|....:
Mouse    61 SAAHCYK----RRLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILN 121

  Fly   130 STIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSS 194
            |.:..:.|..|..:..|...|||||...|.....|:.|:.:...::|.|.|..|   |..||.|:
Mouse   122 SQVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS---YPGQITSN 183

  Fly   195 MICA--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSWV 249
            |.|.  ...|||||.||||||:|..|.:.|:||||..||....||||..|....||:
Mouse   184 MFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 81/223 (36%)
Tryp_SPc 31..252 CDD:238113 82/224 (37%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 81/223 (36%)
Tryp_SPc 24..243 CDD:238113 82/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.