DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf5 and RGD1563991

DIOPT Version :9

Sequence 1:NP_476957.1 Gene:Taf5 / 47900 FlyBaseID:FBgn0010356 Length:704 Species:Drosophila melanogaster
Sequence 2:XP_017457783.1 Gene:RGD1563991 / 367797 RGDID:1563991 Length:255 Species:Rattus norvegicus


Alignment Length:256 Identity:114/256 - (44%)
Similarity:162/256 - (63%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 LMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSC 510
            |.||.||||...|..:.:.|||||||.:||.|.|.:::..|.|:||.||||||..:|:..||.|.
  Rat     4 LRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPYSLYFASG 68

  Fly   511 SYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGH 575
            |:|:|||||:.|....||::.|||:|||||:|||||||:||||:|:|||||....|.||||.|||
  Rat    69 SHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGH 133

  Fly   576 KGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDN 640
            :|.|.||:||..|:||||...|..:.:|||::|:|...|..||.::|::.||.|..::|:|.:||
  Rat   134 RGPVLSLSFSPNGKYLASAGEDQRLELWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDN 198

  Fly   641 NLTLWDFHKVTEDYISNHITVSHHQDENDEDVYLMRTFPSKNSPFVSLHFTRRNLLMCVGL 701
            ::.:||..           :...:...:.....|:..:..:.|..:|:.|...|||:..|:
  Rat   199 SVRVWDIR-----------STCCNTPADGSSGELVGVYTGQMSNVLSVQFMACNLLLVTGI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf5NP_476957.1 TAF5_NTD2 114..245 CDD:176269
WD40 319..674 CDD:225201 106/227 (47%)
WD40 373..646 CDD:238121 104/199 (52%)
WD40 repeat 380..448 CDD:293791 1/1 (100%)
WD40 repeat 454..490 CDD:293791 15/35 (43%)
WD40 repeat 495..531 CDD:293791 18/35 (51%)
WD40 repeat 538..573 CDD:293791 25/34 (74%)
WD40 repeat 579..615 CDD:293791 16/35 (46%)
RGD1563991XP_017457783.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D230914at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.