DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and AT4G00600

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_191969.1 Gene:AT4G00600 / 825813 AraportID:AT4G00600 Length:310 Species:Arabidopsis thaliana


Alignment Length:302 Identity:121/302 - (40%)
Similarity:175/302 - (57%) Gaps:51/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSNMAQIIDGKAIAQEVRTQLAHELKGMEAAGYPKPHLTAVIVGEDPASEKYVANKMVACREVGI 68
            :|..|.:|||||.|:::|..:..|:..|:.:           :|..||.:               
plant    51 SSPSAIVIDGKAEAKKIRDDIKIEVSRMKES-----------IGVVPAED--------------- 89

  Fly    69 SSETKRLPASTTQEELLQLIADLNKDPQVTGILVQLPVPEHINERTICNAVDVDKDVDGFNEVNI 133
                      :::||:|:.::..|.||.|.|:|||||:|.|::|:.|.|||.::||||||:.:||
plant    90 ----------SSEEEVLKYVSGFNDDPSVHGVLVQLPLPSHMDEQNILNAVSIEKDVDGFHPLNI 144

  Fly   134 GRTALDMEAN--IPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMD 196
            ||.|:.....  :|.||.|...||....||..|:.|||:|||..|.:|.|:||..:        |
plant   145 GRLAMRGREPLFVPCTPKGCIELLHRYNIEFKGKRAVVIGRSNIVGMPAALLLQKE--------D 201

  Fly   197 ATVTICH-RYTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDES-TGQFK 259
            |||:|.| |...|:||.   |||||::.|||||.::....:||||.:|||||..::|.| .|..:
plant   202 ATVSIIHSRTMNPEELT---RQADILISAVGKPNMVRGSWIKPGAVLIDVGIKPVEDPSAAGGER 263

  Fly   260 LVGDVDFEEVRQVAGHITPVPGGVGPMTVAMLMHNTLKAARK 301
            ||||:.:.|..::|..||||||.|||||:|||:.|||.:|::
plant   264 LVGDICYVEASKIASAITPVPGDVGPMTIAMLLSNTLTSAKR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 119/297 (40%)
THF_DHG_CYH 10..126 CDD:279147 34/115 (30%)
THF_DHG_CYH_C 129..303 CDD:280955 81/177 (46%)
AT4G00600NP_191969.1 PLN02616 1..310 CDD:215332 121/302 (40%)
THF_DHG_CYH 57..137 CDD:279147 34/115 (30%)
NAD_bind_m-THF_DH_Cyclohyd 132..304 CDD:133448 86/182 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1035
OMA 1 1.010 - - QHG61254
OrthoDB 1 1.010 - - D1004679at2759
OrthoFinder 1 1.000 - - FOG0001810
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - O PTHR48099
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.