DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and Mthfd2l

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006535239.1 Gene:Mthfd2l / 665563 MGIID:1915871 Length:366 Species:Mus musculus


Alignment Length:293 Identity:160/293 - (54%)
Similarity:210/293 - (71%) Gaps:0/293 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AQIIDGKAIAQEVRTQLAHELKGMEAAGYPKPHLTAVIVGEDPASEKYVANKMVACREVGISSET 72
            |.||.|..:|::::.::...::...|.|..:|||:.::||::|||..||.||:.|...|||.||.
Mouse    70 AVIISGTNMAKQIQKEIQQGVESWIALGNRRPHLSIILVGDNPASHTYVRNKIKAASAVGICSEL 134

  Fly    73 KRLPASTTQEELLQLIADLNKDPQVTGILVQLPVPEHINERTICNAVDVDKDVDGFNEVNIGRTA 137
            ...|.:.:|||||.:...||.||:|:|||||||:|:|::||||||.:..:||||||:.:||||..
Mouse   135 IIKPKNVSQEELLDITDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLC 199

  Fly   138 LDMEANIPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMDATVTIC 202
            ||..:.||||...|..:::...|||.|:|.||.||||||.:|:|:|||.||::.....||||||.
Mouse   200 LDQHSLIPATASAVWEIIKRAGIETFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIA 264

  Fly   203 HRYTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDESTGQFKLVGDVDFE 267
            |||||.::|..|.:.||||:||.|.|.|||.|||:.||.|||||||.|:|..||:.|||||||||
Mouse   265 HRYTPREQLKAHTQLADIIIVAAGIPRLITADMVREGAAVIDVGINYIQDPVTGKTKLVGDVDFE 329

  Fly   268 EVRQVAGHITPVPGGVGPMTVAMLMHNTLKAAR 300
            .|::.|..||||||||||||||||:.|||.||:
Mouse   330 AVKKKASFITPVPGGVGPMTVAMLLKNTLLAAK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 159/292 (54%)
THF_DHG_CYH 10..126 CDD:279147 52/115 (45%)
THF_DHG_CYH_C 129..303 CDD:280955 103/172 (60%)
Mthfd2lXP_006535239.1 FolD 72..363 CDD:223268 159/291 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837990
Domainoid 1 1.000 207 1.000 Domainoid score I2876
eggNOG 1 0.900 - - E1_COG0190
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 335 1.000 Inparanoid score I2389
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61254
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001810
OrthoInspector 1 1.000 - - otm43771
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - LDO PTHR48099
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4671
SonicParanoid 1 1.000 - - X1169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.