DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and Mthfd1

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_006240311.1 Gene:Mthfd1 / 64300 RGDID:708531 Length:941 Species:Rattus norvegicus


Alignment Length:294 Identity:116/294 - (39%)
Similarity:181/294 - (61%) Gaps:20/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAQEVRTQLAHELKGM--EAAGYPKPHLTAVIVGEDPASEKYVANKMVACREVGISSETKRLPAS 78
            :::::|.:|..::..|  :..|: .|.|..:.||:...|..|:..|:.|.:|:||.:...:||.:
  Rat    18 VSRQIRNRLKTQVTQMQEQVPGF-TPGLAILQVGDRDDSNLYINVKLKAAQEIGIKATHIKLPRT 81

  Fly    79 TTQEELLQLIADLNKDPQVTGILVQLPVPEH--INERTICNAVDVDKDVDGFNEVNIGRTAL-DM 140
            :|:.|:|:.:..||:|..|.|.:||||:...  ||...:.||:..:|||||...:|.|:.|. |:
  Rat    82 STESEVLKYVISLNEDATVHGFIVQLPLDSENSINTEAVINAIAPEKDVDGLTSINAGKLARGDL 146

  Fly   141 -EANIPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMDATVTICHR 204
             :..||.||.|...|::...::..||:||||||||.|..||..||..:        :||||.||.
  Rat   147 KDCFIPCTPKGCLELIKETGVQIAGRHAVVVGRSKIVGAPMHDLLLWN--------NATVTTCHS 203

  Fly   205 YTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDES--TGQFKLVGDVDFE 267
            .|  .:|.:...:.||:|||.|:|.::..:.:||||.|||.|||.:.|::  .|: |:||||.::
  Rat   204 KT--ADLDKEVNKGDILVVATGQPEMVKGEWIKPGAVVIDCGINYVPDDTKPNGR-KVVGDVAYD 265

  Fly   268 EVRQVAGHITPVPGGVGPMTVAMLMHNTLKAARK 301
            |.::.|..|||||||||||||||||.:|:::|::
  Rat   266 EAKEKASFITPVPGGVGPMTVAMLMQSTVESAQR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 116/294 (39%)
THF_DHG_CYH 10..126 CDD:279147 35/113 (31%)
THF_DHG_CYH_C 129..303 CDD:280955 78/177 (44%)
Mthfd1XP_006240311.1 FolD 17..303 CDD:223268 116/294 (39%)
THF_DHG_CYH 18..131 CDD:279147 35/113 (31%)
NAD_bind_m-THF_DH_Cyclohyd 126..298 CDD:133448 82/182 (45%)
PLN02759 315..941 CDD:178359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.