DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and MTHFD2L

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_016863707.1 Gene:MTHFD2L / 441024 HGNCID:31865 Length:456 Species:Homo sapiens


Alignment Length:260 Identity:135/260 - (51%)
Similarity:180/260 - (69%) Gaps:0/260 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AQIIDGKAIAQEVRTQLAHELKGMEAAGYPKPHLTAVIVGEDPASEKYVANKMVACREVGISSET 72
            |.||.|..:|:.::.::...::...:.|..:|||:.::||::|||..||.||:.|...|||.||.
Human   154 AIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSEL 218

  Fly    73 KRLPASTTQEELLQLIADLNKDPQVTGILVQLPVPEHINERTICNAVDVDKDVDGFNEVNIGRTA 137
            ...|...:|||||.:...||.||:|:|||||||:|:|::||||||.:..:||||||:.:||||..
Human   219 ILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLC 283

  Fly   138 LDMEANIPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMDATVTIC 202
            ||..:.||||...|..:::...|:|.|:|.||.||||||.:|:|:|||.||::.....||||||.
Human   284 LDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIA 348

  Fly   203 HRYTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDESTGQFKLVGDVDFE 267
            |||||.::|..|.:.||||:||.|.|.|||.||||.||.|||||||.:.|..||:.|||||||||
Human   349 HRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFE 413

  Fly   268  267
            Human   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 134/259 (52%)
THF_DHG_CYH 10..126 CDD:279147 51/115 (44%)
THF_DHG_CYH_C 129..303 CDD:280955 79/139 (57%)
MTHFD2LXP_016863707.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147907
Domainoid 1 1.000 208 1.000 Domainoid score I2865
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 338 1.000 Inparanoid score I2386
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61254
OrthoDB 1 1.010 - - D1004679at2759
OrthoFinder 1 1.000 - - FOG0001810
OrthoInspector 1 1.000 - - otm41721
orthoMCL 1 0.900 - - OOG6_100216
Panther 1 1.100 - - LDO PTHR48099
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1169
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.