DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and Mthfd1l

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001164256.1 Gene:Mthfd1l / 270685 MGIID:1924836 Length:977 Species:Mus musculus


Alignment Length:266 Identity:63/266 - (23%)
Similarity:108/266 - (40%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KPHLTAVIVGEDPASEKYVANKMVACREVGISSETKRLPASTTQEELLQLIADLNKDPQVTGILV 102
            ||.|..:..|:|...:....|   ..:|.|:......||..:.::|::..|..:|:||:|.|:.:
Mouse    96 KPVLVVIQAGDDNLMKDMNQN---LAKEAGLDITHICLPPDSGEDEIIDEILKINEDPRVHGLTL 157

  Fly   103 QLPVPEHINERTICNAVDVDKDVDGFNEVNIGRTALDMEANIPATPL--GVKRLLEHMKIETLGR 165
            |  :.|......:.||:..:|||||..::|:|:...........:||  ....|:|...|...|:
Mouse   158 Q--ISEDSLSNKVLNALKPEKDVDGVTDINLGKLVRGDAPECFVSPLAKAAVELVEKSGITLDGK 220

  Fly   166 NAVVVGRSKNVSLPMAILLHADGKYATKAMDATVTICHRYTPPKELARHCRQADIIVVAVGKPGL 230
            ..:|||....:...:..|....|.....        |...||  :|....|:|||:|:...||..
Mouse   221 KVLVVGAHGPLEAALQWLFQRKGSMTMS--------CPWATP--QLPDKLREADIVVLGSPKPEE 275

  Fly   231 ITKDMVKPGACVIDVGINRIKDESTGQFKLVGDVDFEEVRQVAGHITPVPGGVGPMTVAMLMHNT 295
            |....:..|..:    :|...|..:|  ||.|......|.::...     ..|..:..|:.:.|.
Mouse   276 IPAVWIPSGTTI----LNCFHDFLSG--KLSGGSPGVPVDKLIAE-----ESVSLLAAALRIQNM 329

  Fly   296 LKAARK 301
            :.:.|:
Mouse   330 VSSGRR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 63/266 (24%)
THF_DHG_CYH 10..126 CDD:279147 23/87 (26%)
THF_DHG_CYH_C 129..303 CDD:280955 37/175 (21%)
Mthfd1lNP_001164256.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..71
Methylenetetrahydrofolate dehydrogenase and cyclohydrolase 32..347 63/266 (24%)
THF_DHG_CYH 73..179 CDD:279147 23/87 (26%)
FolD 82..>287 CDD:223268 52/205 (25%)
THF_DHG_CYH_C 182..337 CDD:280955 37/175 (21%)
Formyltetrahydrofolate synthetase 348..977
PLN02759 351..977 CDD:178359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.