DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and mthfd1b

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_955823.1 Gene:mthfd1b / 260441 ZFINID:ZDB-GENE-020905-4 Length:934 Species:Danio rerio


Alignment Length:304 Identity:123/304 - (40%)
Similarity:183/304 - (60%) Gaps:26/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AQIIDGKAIAQEVRTQLAHELKGMEAAGYP--KPHLTAVIVGEDPASEKYVANKMVACREVGISS 70
            ||||.||.|:.:||.:|..|::.|:.. :|  :|.|..:.||:...|..|::.|:.|..::||::
Zfish     3 AQIICGKTISAQVRERLKEEVEEMKKT-HPNFEPGLVVLQVGDRDDSNLYISMKLKAAAQIGITA 66

  Fly    71 ETKRLPASTTQEELLQLIADLNKDPQVTGILVQLPVPE-H-INERTICNAVDVDKDVDGFNEVNI 133
            ...:||.:.|:.|:||.:.::|::.::.|::||||:.. | ||...:.|:|..:|||||...:|.
Zfish    67 VHIKLPQTATETEVLQSVTEVNENSKIHGLIVQLPLDSIHTINTERVINSVAPEKDVDGLTSINA 131

  Fly   134 GRTAL-DM-EANIPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILL---HADGKYATK 193
            |:.|. |: :..||.||.|...|::...:...|:.|||:||||.|..||..||   |        
Zfish   132 GKLARGDLGDCFIPCTPNGCMELIKQTGVSLAGKRAVVIGRSKIVGAPMHDLLLWNH-------- 188

  Fly   194 AMDATVTICHRYTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDES--TG 256
               ||||.||..|  .:|.....:|||:|..:|||.::..|.:|.||.|||.|||.|.|.|  :|
Zfish   189 ---ATVTTCHSKT--ADLVSEVGKADILVTGIGKPEMVHGDWLKTGAEVIDCGINTIADSSRPSG 248

  Fly   257 QFKLVGDVDFEEVRQVAGHITPVPGGVGPMTVAMLMHNTLKAAR 300
            : ::||||.::..:..|..|||||||||||||||||.||:.:|:
Zfish   249 K-RVVGDVHYDSAKDRAAFITPVPGGVGPMTVAMLMKNTVLSAK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 122/303 (40%)
THF_DHG_CYH 10..126 CDD:279147 40/119 (34%)
THF_DHG_CYH_C 129..303 CDD:280955 78/179 (44%)
mthfd1bNP_955823.1 FolD 4..293 CDD:223268 122/303 (40%)
THF_DHG_CYH 5..124 CDD:279147 40/119 (34%)
NAD_bind_m-THF_DH_Cyclohyd 119..291 CDD:133448 82/185 (44%)
PLN02759 305..934 CDD:178359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.