DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and MTHFD1L

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_005266964.1 Gene:MTHFD1L / 25902 HGNCID:21055 Length:986 Species:Homo sapiens


Alignment Length:209 Identity:50/209 - (23%)
Similarity:92/209 - (44%) Gaps:17/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KPHLTAVIVGEDPASEKYVANKMVACREVGISSETKRLPASTTQEELLQLIADLNKDPQVTGILV 102
            ||.|..:..|:|...::...|   ...|.|::.....||..:::.|::..|..:|:|.:|.|:.:
Human    97 KPVLAIIQAGDDNLMQEINQN---LAEEAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLAL 158

  Fly   103 QLPVPEHINERTICNAVDVDKDVDGFNEVNIGRTALD--MEANIPATPLGVKRLLEHMKIETLGR 165
            |  :.|::....:.||:..:|||||..::|:|:....  .|..:......|..|||...:...|:
Human   159 Q--ISENLFSNKVLNALKPEKDVDGVTDINLGKLVRGDAHECFVSPVAKAVIELLEKSGVNLDGK 221

  Fly   166 NAVVVGRSKNVSLPMAILLHADGKYATKAMDATVTICHRYTPPKELARHCRQADIIVVAVGKPGL 230
            ..:|||...::...:..|....|.........|          ::|.....:|||:|:...||..
Human   222 KILVVGAHGSLEAALQCLFQRKGSMTMSIQWKT----------RQLQSKLHEADIVVLGSPKPEE 276

  Fly   231 ITKDMVKPGACVID 244
            |....::||..|::
Human   277 IPLTWIQPGTTVLN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 50/209 (24%)
THF_DHG_CYH 10..126 CDD:279147 22/87 (25%)
THF_DHG_CYH_C 129..303 CDD:280955 25/118 (21%)
MTHFD1LXP_005266964.1 FolD 72..>288 CDD:223268 49/205 (24%)
THF_DHG_CYH 74..180 CDD:279147 22/87 (25%)
NAD_bind_m-THF_DH_Cyclohyd_like 193..335 CDD:133451 23/108 (21%)
PLN02759 352..949 CDD:178359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.