DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and SPBC839.16

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_595256.1 Gene:SPBC839.16 / 2541217 PomBaseID:SPBC839.16 Length:937 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:133/311 - (42%)
Similarity:182/311 - (58%) Gaps:23/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MAQIIDGKAIAQEVRTQLAHELKGMEAAG-YPKPHLTAVIVGEDPASEKYVANKMVACREVGISS 70
            ||.:::|.::|::||.:|..::..:::.. |....|..:.||....|..||..|..|..|.|||.
pombe     1 MALLLEGTSLARKVREELREQISSIKSVDPYFNVSLKIIQVGGREDSNVYVRMKTRAANEAGISC 65

  Fly    71 ETKRLPASTTQEELLQLIADLNKDPQVTGILVQLPVPEHINERTICNAVDVDKDVDGFNEVNIGR 135
            |....|...|:.:||..|...|:||.|.||:||||:|.||||:.|..||..:||||||.|.|:|:
pombe    66 EHVNFPEDITEYDLLLAIKGFNEDPTVHGIIVQLPLPAHINEQIITEAVAPEKDVDGFCETNLGK 130

  Fly   136 TALDMEANIP----ATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMD 196
              |......|    .||.|:..:|:|..|...|::|||:|||..|..||:|||.       || :
pombe   131 --LTKREGQPLFTACTPKGIMCILKHYGINVQGKHAVVIGRSNIVGRPMSILLE-------KA-N 185

  Fly   197 ATVTICHRYTPPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKD--ESTGQFK 259
            ||||:||..|  :.:|...|.|||:|.|:|.|..:..|.:|.|...||||||.|.|  :.:| ::
pombe   186 ATVTLCHSKT--ESIADIVRTADIVVAAIGIPHFVKADWLKKGVVAIDVGINSIPDATKKSG-YR 247

  Fly   260 LVGDVDFEEVRQVAGHITPVPGGVGPMTVAMLMHNTLKAA---RKQFDDRK 307
            |.||:|||..::||..||||||.|||||||||:.|.:::|   ||....||
pombe   248 LTGDIDFENAKEVASAITPVPGSVGPMTVAMLLQNVVESAVRFRKMSRKRK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 129/304 (42%)
THF_DHG_CYH 10..126 CDD:279147 44/116 (38%)
THF_DHG_CYH_C 129..303 CDD:280955 81/182 (45%)
SPBC839.16NP_595256.1 FolD 4..294 CDD:223268 129/302 (43%)
THF_DHG_CYH 4..121 CDD:279147 44/116 (38%)
THF_DHG_CYH_C 127..291 CDD:280955 78/176 (44%)
PLN02759 304..937 CDD:178359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.