DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdmc and mthfd1l

DIOPT Version :9

Sequence 1:NP_476929.1 Gene:Nmdmc / 47895 FlyBaseID:FBgn0010222 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001229925.1 Gene:mthfd1l / 100034522 ZFINID:ZDB-GENE-041001-133 Length:978 Species:Danio rerio


Alignment Length:296 Identity:74/296 - (25%)
Similarity:134/296 - (45%) Gaps:38/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAQEVRTQLAHELK--GMEAAGYPKPHLTAVIVGEDPASEKYVANKMVACREVGISSETKRLPAS 78
            |.|..|    .|||  |....|. ||.|..:..|||....:  .||.:| .::|::.....||..
Zfish    81 IVQRCR----EELKSIGENNPGL-KPTLAIIQAGEDDGLLE--MNKKMA-GKIGLNVMQICLPHR 137

  Fly    79 TTQEELLQLIADLNKDPQVTGILVQLPVPEHINERTICNAVDVDKDVDGFNEVNIGRTALDMEAN 143
            .|:||:::.:..||||.:|.||.:.|  |:....:::.||:...|||||..::|:||..|..:.:
Zfish   138 CTEEEVIEEVLRLNKDSRVHGIFLHL--PQTFLSKSVRNAIKPQKDVDGVCDLNVGRVVLGDKTD 200

  Fly   144 IPATPL--GVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHADGKYATKAMDATVTICHRYT 206
            ...:|:  .|..||.......:|:.||:||....:.:.:..||..:|        ..:..| |::
Zfish   201 GFTSPVAGAVLELLAKHDAPLVGKMAVLVGLEGPLKVALQCLLQNNG--------MILQTC-RWS 256

  Fly   207 PPKELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDESTGQFKLVGDVDFEEVRQ 271
             ...|.:....:|:::........|....::||...|::|...:::........|      |.:.
Zfish   257 -STNLQKQIMDSDVVITLNTNQNHIPSTWLRPGVAAINLGSALLEEHPDSWEATV------EAQS 314

  Fly   272 VAGHITPVPGGVGPMTVAMLMHNTLKAARKQFDDRK 307
            .|        |:||:|.|..|.:.::::|:...:::
Zfish   315 AA--------GLGPLTAAFRMQHVVRSSRRWIQEQQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NmdmcNP_476929.1 FolD 9..304 CDD:223268 74/291 (25%)
THF_DHG_CYH 10..126 CDD:279147 36/111 (32%)
THF_DHG_CYH_C 129..303 CDD:280955 35/175 (20%)
mthfd1lNP_001229925.1 THF_DHG_CYH 80..183 CDD:279147 36/111 (32%)
FolD 81..336 CDD:223268 73/288 (25%)
NADB_Rossmann 196..335 CDD:304358 30/162 (19%)
PLN02759 352..978 CDD:178359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100216
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.