DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and PHOX2B

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens


Alignment Length:301 Identity:91/301 - (30%)
Similarity:114/301 - (37%) Gaps:121/301 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAK 207
            |...:...||.||.|||||:.||.:|||.|.:|.|||::|||:||:::||:||||||||||||||
Human    88 DHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAK 152

  Fly   208 WRKRE------------------------------KFMNQDKAGYLLPEQ-------------GL 229
            :||:|                              |..:.|..|...|..             |.
Human   153 FRKQERAAAAAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGG 217

  Fly   230 PEFPLGIP--LPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHT 292
            |. |.|.|  ..|.|..|.||.                ..||||||.                  
Human   218 PS-PAGAPGAAGPGGPGGEPGK----------------GGAAAAAAA------------------ 247

  Fly   293 LLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHP 357
                           .|.||||||||:||         ||:|.         ..|.:.  ..|.|
Human   248 ---------------AAAAAAAAAAAAAG---------GLAAA---------GGPGQG--WAPGP 277

  Fly   358 TPPHATPPAGGNGGGGLLTGGLISTAAQSPNSAAGASSNAS 398
            .|..:.|.:.|.....:|      ::.|.||.|..|...:|
Human   278 GPITSIPDSLGGPFASVL------SSLQRPNGAKAALVKSS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 36/52 (69%)
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 36/52 (69%)
polyalanine repeat 241..260 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4690
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.