DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and HB51

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:138 Identity:38/138 - (27%)
Similarity:63/138 - (45%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SPTNTDGG--LDVDNDDELSSSL---NNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQY 177
            :|.:|..|  :.|...:::.::.   ||.:::        :::.|  .|:.||..|||:|::...
plant    44 TPGDTQTGPVISVPESEKIMNAYRFPNNNNEM--------IKKKR--LTSGQLASLERSFQEEIK 98

  Fly   178 PDVFTREDLAMRLDLSEARVQVWFQNRRAKWR------------------KREKFMNQD---KAG 221
            .|...:..|:..|.|...::.||||||||:|:                  .|||.|..|   |..
plant    99 LDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLR 163

  Fly   222 YLLPEQGL 229
            .||.:|||
plant   164 ALLRDQGL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 20/52 (38%)
HB51NP_195999.2 Homeobox 77..130 CDD:395001 20/54 (37%)
HALZ 132..167 CDD:396657 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.