DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and HB-3

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:167 Identity:42/167 - (25%)
Similarity:68/167 - (40%) Gaps:37/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PHHG------HPHHIHHLHSSNS-----------NGSNHLSHQQQQQHSQQQHHSQQQQQQQQLQ 110
            |.||      |..:.|||.|..|           .|.|::.::.........||...|:      
plant    25 PQHGFMFQQLHEDNAHHLPSPTSLPSCPPHLFYGGGGNYMMNRSMSFTGVSDHHHLTQK------ 83

  Fly   111 VQAKREDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKT 175
                   |||.|:   ::::.|::....|...|.|.|....|.:|    ....|:..||::||..
plant    84 -------SPTTTN---NMNDQDQVGEEDNLSDDGSHMMLGEKKKR----LNLEQVRALEKSFELG 134

  Fly   176 QYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKRE 212
            ...:...:..||..|.|...::.:|||||||:|:.::
plant   135 NKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 16/52 (31%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 18/56 (32%)
HALZ 170..208 CDD:280364 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.