DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and HAT1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:179 Identity:47/179 - (26%)
Similarity:72/179 - (40%) Gaps:45/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HHLHSSNSNGSNHLSHQQQQQHSQQQHHSQQQQQQQQLQ----------VQAKRE---DSPTNT- 122
            |.|..:....|:.:|:.|....:|....|..||:||.|:          |..:.|   .||.:| 
plant    20 HPLQLNLKPTSSPMSNLQMFPWNQTLVSSSDQQKQQFLRKIDVNSLPTTVDLEEETGVSSPNSTI 84

  Fly   123 -----------------DGGLDVDNDDELSSSLNNGHDLSDMERP-------RKVRRSRTTFTTF 163
                             .||...|.|..|..|.:.|  .||.|..       :|:|.|:.     
plant    85 SSTVSGKRRSTEREGTSGGGCGDDLDITLDRSSSRG--TSDEEEDYGGETCRKKLRLSKD----- 142

  Fly   164 QLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKRE 212
            |...||..|::....:...:..||.:|.|:..:|:||||||||:.:.::
plant   143 QSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 18/52 (35%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 17/77 (22%)
HOX 134..188 CDD:197696 20/58 (34%)
HALZ 190..233 CDD:128634 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.