DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and HB6

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:288 Identity:68/288 - (23%)
Similarity:100/288 - (34%) Gaps:79/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EDSPTNTDGG-----LDVDNDDELSSSLNNGH-DLSDMERPRKVRRSRTTFTTFQLHQLERAFEK 174
            |.||....|.     |:...::|.:.....|| .||:.:|...:.         |:..||:.||.
plant    25 EQSPRRYGGREFQSMLEGYEEEEEAIVEERGHVGLSEKKRRLSIN---------QVKALEKNFEL 80

  Fly   175 TQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKR--EKFMNQDKAGY--------------- 222
            ....:...:..||..|.|...:|.||||||||:|:.:  ||.....|..|               
plant    81 ENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSLRRDNE 145

  Fly   223 -LLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAGL--------LPQ 278
             ||.|         |......|.|..|..:.|          ..|.|....:.:        ||:
plant   146 SLLQE---------ISKLKTKLNGGGGEEEEE----------ENNAAVTTESDISVKEEEVSLPE 191

  Fly   279 HLMAPHYKLPNF--HTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMSQVSPP 341
            .:.......|.|  |:....|...::|..:....|||::.||:||...:....|.|:..|     
plant   192 KITEAPSSPPQFLEHSDGLNYRSFTDLRDLLPLKAAASSFAAAAGSSDSSDSSALLNEES----- 251

  Fly   342 CSNSSPRESPKLVPHPTPPHATPPAGGN 369
             |::....:|..||           |||
plant   252 -SSNVTVAAPVTVP-----------GGN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 18/52 (35%)
HB6NP_565536.1 Homeobox 62..115 CDD:278475 19/61 (31%)
HALZ 117..158 CDD:280364 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.