DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ALX1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_008913.2 Gene:ALX1 / 8092 HGNCID:1494 Length:326 Species:Homo sapiens


Alignment Length:254 Identity:82/254 - (32%)
Similarity:112/254 - (44%) Gaps:75/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QHHSQQQQQQ--QQLQVQ---AKREDSPTNTDGGLDVDNDDELSSSLNNG-------HDLSDM-- 147
            :||.:.::..  |...|.   .|.|..|.:|:....:||.:.|..|...|       .:|.|.  
Human    60 EHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCD 124

  Fly   148 --ERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRK 210
              ....|.||.|||||:.||.:||:.|:||.||||:.||.||:|.:|:|||||||||||||||||
Human   125 SNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRK 189

  Fly   211 REKF--MNQDKAGY-------LLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFN 266
            ||::  :.|.|:.:       :||.  ...:|               .:|:..|           
Human   190 RERYGQIQQAKSHFAATYDISVLPR--TDSYP---------------QIQNNLW----------- 226

  Fly   267 PAAAAAAG------LLPQ---HLMAPHYKLPNFHTLLSQYMGLSN---------LNGIF 307
             |..|:.|      :||:   ..|.|:...|...   |.|.|.||         ||..|
Human   227 -AGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTD---SSYTGFSNHQNQFSHVPLNNFF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 36/52 (69%)
ALX1NP_008913.2 Homeobox 135..189 CDD:365835 37/53 (70%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 23/122 (19%)
OAR 302..320 CDD:367680
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.