DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ESX1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_703149.1 Gene:ESX1 / 80712 HGNCID:14865 Length:406 Species:Homo sapiens


Alignment Length:401 Identity:97/401 - (24%)
Similarity:139/401 - (34%) Gaps:143/401 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QESPVSRPRAVYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSNGSNHLSHQQQ 90
            :|:..|:|......:..:|.:..:...|...|                      .|..| ..:||
Human    44 EENTRSKPEYGTEAENNVGTEGSVPSDDQDRE----------------------GGGGH-EPEQQ 85

  Fly    91 QQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRR 155
            |:........|||::...|:::.::|:.|..|..|.......:.:..         .:.|.:.||
Human    86 QEEPPLTKPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEG---------PQPPERKRR 141

  Fly   156 SRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFM----- 215
            .||.||.|||.:||..|:::|||||..||.||.||:|:|.|||||||||||||::.::.:     
Human   142 RRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTEDRVQVWFQNRRAKWKRNQRVLMLRNT 206

  Fly   216 -NQDKAGYL-------------------------------LPEQGLPEFPLGIPLPPHG------ 242
             ..|.|..|                               ||...:|..|..:|:||..      
Human   207 ATADLAHPLDMFLGGAYYAAPALDPALCVHLVPQLPRPPVLPVPPMPPRPPMVPMPPRPPIAPMP 271

  Fly   243 --LPGHPGSMQSEF-----------WPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLL 294
              .|..|||..:..           |||              .|.:.|...|||   :|      
Human   272 PMAPVPPGSRMAPVPPGPRMAPVPPWPP--------------MAPVPPWPPMAP---VP------ 313

  Fly   295 SQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMSQV--SPPCSNSSPRESPKLVP-H 356
                            .....|....|.|           |::|  .||.:...|  .|.:.| .
Human   314 ----------------TGPPMAPVPPGPP-----------MARVPPGPPMARVPP--GPPMAPLP 349

  Fly   357 PTPPHATPPAG 367
            |.||.|..|.|
Human   350 PGPPMAPLPPG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 35/52 (67%)
ESX1NP_703149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..142 21/129 (16%)
Nuclear localization signal. /evidence=ECO:0000255 138..143 2/4 (50%)
Homeobox 142..195 CDD:278475 35/52 (67%)
15 X 9 AA tandem repeats of P-P-x-x-P-x-P-P-x 244..378 36/169 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..364 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.